Skip to product information

LL-37

LL-37

SKU:Immune Defense Support

$119.99 $139.99 SAVE $20
In Stock Badge

chat 24/7 Customer Support

labs Lab tested for purity & quality

local_shipping Ships from Canada within 24 hours

 
Canadian Flag
Canada’s only domestic premium peptide manufacturer

Polar Peptides is Canada’s only domestic manufacturer and supplier of premium research peptides, with production and fulfillment handled in Canada. While many sellers rely on imported vials from overseas suppliers, our domestic process allows us to maintain closer oversight over quality, consistency, packaging, and labeled vial weight.

By keeping peptide production closer to home, we can better control product standards, reduce reliance on uncertain imported inventory, and provide Canadian researchers with a more transparent and reliable source for research peptides.

Do not be fooled by vague “Made in Canada” claims. Many companies may ship from Canada while still sourcing finished vials from overseas. Polar Peptides is focused on true domestic manufacturing, premium research quality, fast Canadian shipping, and dependable customer support.

LL-37 is a naturally occurring antimicrobial peptide that strengthens immune defenses and promotes tissue healing. It plays a role in fighting pathogens, reducing inflammation, and accelerating recovery from injuries or infections. LL-37 supplementation supports overall immunity, improves skin and wound healing, and enhances the body’s natural protective barriers.

Product Info

Molecular formula: C178H303N51O34
Molecular weight: 4493.0
Purity: 99%+
Sequence: [LL-37, 37 aa]

Most standard lyophilized research vials are commonly prepared using 2mL of bacteriostatic water unless otherwise specified directly on the product page or vial label.

For best handling, slowly add the bacteriostatic water down the inside wall of the vial rather than directly onto the powder. This helps reduce unnecessary agitation and supports product integrity during laboratory use.

After adding bacteriostatic water, gently swirl or roll the vial until the lyophilized powder has fully dissolved. Avoid aggressive shaking, as excessive agitation may affect product stability.

Prepared vials should typically be stored refrigerated between 2-8°C for best stability. Lyophilized vials that have not yet been prepared should be stored in a cool, dry environment away from direct sunlight, moisture, and excessive heat.

Proper storage and handling procedures are important for maintaining product purity, consistency, and reliability throughout laboratory applications.

Use our calculator for accurate concentration calculations, measurement planning, and preparation guidance:

Peptide Calculator

Polar Peptides provides premium-quality research products, laboratory-use compounds, and analytical materials with fast Canadian shipping and strict quality control standards.

All products sold by Polar Peptides are intended strictly for research use only and are not intended for human consumption, medical use, diagnostic use, or any other unauthorized use.

Lyophilized research products should be stored in a cool, dry environment prior to preparation to help maintain long-term stability and purity.

Refrigeration is recommended for most products after opening. Prepared vials should remain refrigerated between 2-8°C and protected from repeated temperature changes.

Exposure to excessive moisture, heat, direct sunlight, or frequent freeze-thaw cycles may negatively impact product stability during laboratory applications.

Polar Peptides supplies high-purity research products, peptide blends, laboratory-use materials, and advanced analytical compounds manufactured with quality, consistency, and secure packaging in mind.

Proper storage and handling procedures are recommended to maintain product integrity, consistency, and analytical reliability throughout laboratory research environments.

Disclaimer: All peptides are for laboratory research use only. Not for human consumption. We do not accept liability for misuse. (view full Terms of Use)
View full details

Real customer experiences

Customer reviews

Read verified feedback and product experiences shared by our customers.

Authentic customer feedback
0.0 / 5

Based on 0 reviews

Purchased from us?

Share an honest review to help other customers shop with confidence.

Loading reviews...

Loading customer reviews

You may also like

GHK-Cu

$59.99 From $49.99 CAD

CJC-1295 + Ipamorelin

$104.99 From $94.99 CAD

BPC-157

$102.99 From $92.99 CAD

MOTS-c

$74.99 From $64.99 CAD

BPC-157 + TB-500

$199.99 From $179.99 CAD

AOD-9604

$69.99 From $59.99 CAD

NAD+

$149.99 From $129.99 CAD

MT-2 (Melanotan II)

$69.99 From $59.99 CAD

Klow

$249.99 From $219.99 CAD

Semax Nasal Spray

$139.99 From $119.99 CAD

Selank Nasal Spray

$139.99 From $119.99 CAD

Glow

$219.99 From $199.99 CAD

MT-1 (Melanotan I)

$69.99 From $59.99 CAD

KPV

$84.99 From $74.99 CAD

BPC-157 Capsules

$209.99 From $199.99 CAD

DSIP

$64.99 From $54.99 CAD

Kisspeptin

$69.99 From $59.99 CAD

Epitalon

$64.99 From $54.99 CAD

SS-31

$89.99 From $79.99 CAD

Ipamorelin

$102.99 From $59.99 CAD

SLU-PP-332

$169.99 From $149.99 CAD

5-Amino-1MQ

$94.99 From $84.99 CAD

Pinealon

$49.99 From $39.99 CAD

Glutathione

$169.99 From $149.99 CAD

GLOW Nasal Spray

$139.99 From $119.99 CAD

Thymosin Alpha-1

$99.99 From $89.99 CAD

BPC-157 + TB-500 Nasal Spray

$139.99 From $119.99 CAD

AOD-9604 Nasal Spray

$139.99 From $119.99 CAD

Melanotan 2 Nasal Spray

$139.99 From $119.99 CAD

BPC-157 Nasal Spray

$139.99 From $119.99 CAD

Cerebrolysin

$219.99 From $199.99 CAD

GHRP-6

$69.99 From $39.99 CAD

Thymalin

$69.99 From $59.99 CAD

Epitalon Nasal Spray

$139.99 From $119.99 CAD

VIP

$79.99 From $69.99 CAD

LL-37

$139.99 From $119.99 CAD

KPV Nasal Spray

$139.99 From $119.99 CAD

Hexarelin

$114.99 From $99.99 CAD

GHRP-2

$69.99 From $39.99 CAD