LL-37
LL-37
SKU:Immune Defense Support
24/7 Customer Support
Lab tested for purity & quality
Ships from Canada within 24 hours
Polar Peptides is Canada’s only domestic manufacturer and supplier of premium research peptides, with production and fulfillment handled in Canada. While many sellers rely on imported vials from overseas suppliers, our domestic process allows us to maintain closer oversight over quality, consistency, packaging, and labeled vial weight.
By keeping peptide production closer to home, we can better control product standards, reduce reliance on uncertain imported inventory, and provide Canadian researchers with a more transparent and reliable source for research peptides.
Do not be fooled by vague “Made in Canada” claims. Many companies may ship from Canada while still sourcing finished vials from overseas. Polar Peptides is focused on true domestic manufacturing, premium research quality, fast Canadian shipping, and dependable customer support.
LL-37 is a naturally occurring antimicrobial peptide that strengthens immune defenses and promotes tissue healing. It plays a role in fighting pathogens, reducing inflammation, and accelerating recovery from injuries or infections. LL-37 supplementation supports overall immunity, improves skin and wound healing, and enhances the body’s natural protective barriers.
Product Info
Molecular formula: C178H303N51O34
Molecular weight: 4493.0
Purity: 99%+
Sequence: [LL-37, 37 aa]
Most standard lyophilized research vials are commonly prepared using 2mL of bacteriostatic water unless otherwise specified directly on the product page or vial label.
For best handling, slowly add the bacteriostatic water down the inside wall of the vial rather than directly onto the powder. This helps reduce unnecessary agitation and supports product integrity during laboratory use.
After adding bacteriostatic water, gently swirl or roll the vial until the lyophilized powder has fully dissolved. Avoid aggressive shaking, as excessive agitation may affect product stability.
Prepared vials should typically be stored refrigerated between 2-8°C for best stability. Lyophilized vials that have not yet been prepared should be stored in a cool, dry environment away from direct sunlight, moisture, and excessive heat.
Proper storage and handling procedures are important for maintaining product purity, consistency, and reliability throughout laboratory applications.
Use our calculator for accurate concentration calculations, measurement planning, and preparation guidance:
Polar Peptides provides premium-quality research products, laboratory-use compounds, and analytical materials with fast Canadian shipping and strict quality control standards.
All products sold by Polar Peptides are intended strictly for research use only and are not intended for human consumption, medical use, diagnostic use, or any other unauthorized use.
Lyophilized research products should be stored in a cool, dry environment prior to preparation to help maintain long-term stability and purity.
Refrigeration is recommended for most products after opening. Prepared vials should remain refrigerated between 2-8°C and protected from repeated temperature changes.
Exposure to excessive moisture, heat, direct sunlight, or frequent freeze-thaw cycles may negatively impact product stability during laboratory applications.
Polar Peptides supplies high-purity research products, peptide blends, laboratory-use materials, and advanced analytical compounds manufactured with quality, consistency, and secure packaging in mind.
Proper storage and handling procedures are recommended to maintain product integrity, consistency, and analytical reliability throughout laboratory research environments.
Peptides are short chains of amino acids that are commonly studied in laboratory and analytical research settings. They are often used in research to better understand molecular structure, peptide stability, receptor interaction, and biological signaling pathways.
Different peptide compounds may be studied for a variety of research categories, including peptide chemistry, cellular signaling, protein interaction, formulation testing, analytical comparison, and compound stability evaluation.
Polar Peptides provides research peptides and laboratory-use compounds with a focus on purity, consistency, secure packaging, and fast Canadian fulfillment.
All products are supplied for laboratory research purposes only and should be handled in accordance with proper research standards and applicable regulations.
All orders are shipped directly from our Canadian fulfillment centre, allowing customers across Canada to receive research products quickly and reliably.
Orders are typically processed within 24 hours from Monday to Friday. Delivery usually takes 2–5 business days depending on your location, carrier availability, and the shipping method selected at checkout.
Once your order has shipped, you will receive a confirmation email with tracking information so you can monitor your package throughout transit.
We focus on secure packaging, reliable fulfillment, and fast Canadian shipping to provide a smooth ordering experience from checkout to delivery.
We currently accept secure payments via Interac e-Transfer, one of the most trusted and commonly used payment methods for Canadian customers.
After placing your order, you will automatically receive an email with clear payment instructions. Following these instructions carefully helps ensure your payment is matched to your order quickly and accurately.
Your order will be prepared and shipped once payment has been received and confirmed by our system.
Need step-by-step guidance? View our full payment instructions here:
View Full Payment Instructions
We aim to keep the checkout and payment process simple, secure, and efficient for customers ordering research products in Canada.
Each vial contains peptides at approximately 104% of the labeled amount, helping support consistency and accuracy for laboratory research applications.
Products are supplied in lyophilized, freeze-dried powder form. Lyophilization is commonly used to help preserve peptide stability during shipping and storage prior to preparation.
Our standard peptide vials are approximately 16mm in diameter and 38mm in height, with a maximum fill capacity of 3mL. This standardized vial format is commonly used for research product handling and storage.
Peptides requiring preparation may be paired with bacteriostatic water for laboratory use. Bacteriostatic water is available here: Bacteriostatic Water.
We do not ship products in pre-mixed liquid form. Supplying products in lyophilized powder form helps support stability during transit and storage.
Polar Peptides uses quality-control procedures designed to verify peptide purity, identity, and consistency before products are made available.
Testing may include analytical methods such as HPLC and Mass Spectrometry, which are commonly used in peptide quality verification to evaluate purity percentage, molecular identity, and batch consistency.
Certificates of Analysis, also known as COAs, can be provided upon request when available. These reports may include purity data, batch identification, and relevant analytical testing details.
Note: Due to laboratory processing times, batch turnover, supplier timelines, and the number of products we offer, COAs may not always be immediately available for every batch. We always strive to provide the most accurate and up-to-date documentation possible.
Our goal is to maintain transparency, quality, and trust for customers searching for reliable research products in Canada.
Product quality is one of the most important factors when choosing a Canadian research supplier. Polar Peptides focuses on sourcing high-purity compounds with consistent labeling, secure packaging, and reliable fulfillment.
Our catalog includes popular research categories such as peptide blends, growth hormone research compounds, mitochondrial research compounds, cosmetic peptide research materials, and other advanced laboratory-use products.
Each product page is designed to provide clear product details, molecular information when available, vial specifications, quality information, and product handling guidance.
We continue to improve our product pages, testing transparency, educational resources, and customer support to make Polar Peptides a trusted source for research products in Canada.
Polar Peptides was built to provide Canadian customers with fast access to premium research products, clear product information, responsive support, and reliable fulfillment.
We focus on the details that matter: high-purity products, secure packaging, fast Canadian shipping, transparent communication, and a growing library of research-focused educational resources.
Whether you are looking for peptide research compounds, laboratory-use products, analytical materials, or advanced research compounds, our goal is to provide a smooth and professional ordering experience.
Polar Peptides is committed to becoming one of Canada’s most trusted online sources for research-use products.
Our team is available to help with order questions, tracking updates, payment instructions, product availability, COA requests, and general customer support.
If you need assistance before or after placing an order, you can contact us directly and we will do our best to respond as quickly as possible.
We aim to provide a professional, reliable, and transparent customer experience for every order placed through Polar Peptides.
Research Resources
Explore peptide testing, education, and research resources for the Canadian scientific community.
COA Reports
View available Certificates of Analysis and batch-specific peptide laboratory reports.
View Reports →Learning Centre
Take our research quiz and learn about peptides, laboratory handling, and research fundamentals.
Start Learning →Research Library
Explore Canadian peptide research articles, compound guides, education, and industry updates.
Explore Articles →Couldn't load pickup availability
Trending Products

Real customer experiences
Customer reviews
Read verified feedback and product experiences shared by our customers.
Based on 0 reviews
Purchased from us?
Share an honest review to help other customers shop with confidence.
Share your experience
Write a review
Tell us what stood out. Your feedback helps us improve and helps others make informed decisions.