BPC 157, BPC157, BPC-157 peptide, buy BPC 157, BPC 157 Canada, TB500, TB-500, Thymosin Beta 4, TB4 peptide, GHK-Cu, copper peptide, cu peptide, CJC-1295, CJC1295 DAC, CJC no DAC, Ipamorelin, GHRP-2, GHRP-6, Hexarelin, Sermorelin, Tesamorelin, Retatrutide, Tirzepatide, Semaglutide, AOD9604, MOTS-C, SS-31 peptide, Melanotan 1, Melanotan 2, MT-1, MT-2, dsip, Delta sleep peptide, Thymosin Alpha 1, Thy1, 5-amino-1MQ, 5 amino MQ, IGF-1 LR3, IGF1 LR3, IGF-1 DES, IGF DES, PEG-MGF, MGF peptide, Follistatin 344, Follistatin 315, FST344, ACE-031, HGH fragment, hgh frag 176-191, HGH 191aa, hgh research peptide, research peptides Canada, peptides Canada, Canadian peptide supplier, best peptide supplier Canada, buy peptides online Canada, injectable peptides, peptide research chemicals, peptide vials, peptide therapies, muscle growth peptides, fat loss peptide, healing peptide, recovery peptide, anti-aging peptides, collagen peptides, gut healing peptides, metabolic peptides, insulin sensitivity peptide, anti inflammatory peptides, tendon healing peptide, ligament healing peptide, cartilage repair peptide, skin repair peptide, hair growth peptide, pigmentation peptide, tanning peptide, melanocyte stimulating hormone peptide, MSH peptide, peptide for weight loss, peptide for muscle gain, peptide bodybuilding, peptide stacks, peptide protocols, peptide dosage info, peptide cycles, peptide effects, peptide benefits, peptide side effects research, GMP peptides, lyophilized peptides, peptide reconstitution, bacteriostatic water, bac water, peptide supplies, peptide syringes, sterile syringes, insulin syringes 1ml, 29g syringes, peptide calculators, reconstitution calculators, mg to ml calculator, peptide concentration calculator, peptide mixing, peptide injections, subcutaneous injection info, peptide vial storage, peptide cold storage, freeze dried peptide stability, long term peptide storage, peptide amino acid chains, peptide hormones, peptide GHRH analogs, GHRH peptide, GHS peptides, growth hormone secretagogue, growth hormone releasing hormone, growth hormone booster peptide, GH booster, metabolic reprogramming peptide, mitochondrial peptide, mitochondrial optimization peptide, mitochondrial function repair, cellular regeneration peptides, DNA repair peptides, inflammation reducing peptide, nootropic peptides, brain peptides, neuroprotective peptides, cognitive enhancement peptides, anti-fatigue peptide, fat oxidation peptide, visceral fat reduction peptide, weight management peptide, glucose disposal peptide, insulin mimetic peptide, appetite suppression peptide, GLP-1 agonist peptide, peptide research supply Canada, legal peptides Canada, peptides for lab use, SARMs and peptides, lab-grade peptides, pure peptides Canada, USP-grade peptides, HPLC tested peptides, peptide certificates of analysis, COA peptides, sterile peptide supply, peptide effects research, unmodified peptides, peptide hormone analog, peptide analogs, regenerative medicine peptides, peptide for healing injuries, peptide for joint pain, peptide for performance, athletic recovery peptide, sports performance peptide, peptide for muscle density, peptide for lean mass, peptide for definition, peptide body fat reduction, anti-obesity peptide, lipolytic peptide, appetite control peptide, metabolic enhancement peptide, bioactive peptides, therapeutic peptides, peptide sequences, peptide vial discounts, Canadian peptide shop, peptides online Canada, peptide store Canada, peptide shipping Canada, peptide provider, trusted peptide supplier, premium peptide purity, research-grade compounds, lab compounds, amino acid peptides, polypeptides, small chain peptides, peptide blends, multi-peptide stacks, bodybuilding research chemicals, pharma peptides, injectable research compounds, advanced peptide formulas, peptide optimization, peptide stacking guide, peptide combination therapy, safe peptide research, peptide education, peptide information, injectable compounds, GLP1 peptide, GIP peptide, dual agonist peptide, triple agonist peptide, Retatrutide weight loss research, Tesamorelin visceral fat reduction, BPC 157 healing effects, BPC digestion healing, gut peptide, peptide for IBS research, tendon regeneration peptide, TB500 healing research, ss31 mitochondrial peptide, MOTS-C metabolic peptide, 5-Amino-1MQ fat cell reduction, IGF1 muscle growth signal, IGF LR3 anabolic research, melanotan tanning peptide, MT2 tanning effects, melanocyte activation peptide, copper peptide skin repair, GHK-Cu anti-aging research, collagen synthesis peptide, peptide for wrinkles, peptide for youthfulness, peptide tightening skin, peptide hair follicle support, peptide anti-gray hair, peptide for sleep improvement, DSIP sleep peptide, hormonal peptide analogues, peptide endocrine research, peptide labs Canada, top rated peptide supplier, peptide online ordering, peptide fulfillment Canada, peptide ecommerce store, peptide promotions Canada, peptide wholesale Canada, peptide affiliate program, advanced peptide research Canada, peptide injection knowledge, optimal peptide mixing, peptide vial purity, peptide manufacturing standards, recombinant peptides, bioidentical peptides, peptide molecular structure, peptide pharmacology, peptide absorption research, peptide half-life information, peptide binding affinity, peptide potency, peptide stability, peptide application research, performance enhancement compounds, fitness peptides, gym peptides, athletic peptides, natural healing peptides, regenerative peptides, restorative peptides, longevity peptides, anti-aging compounds, peptide stacks for fat loss, peptide stacks for muscle building, peptide stacks for recovery, peptide stacks for anti-aging, peptide stacks for healing, Canada peptide reviews, buy peptides legally Canada, peptide reference guide, peptide glossary, peptide synonyms, all peptide names list, amino chain compounds, peptide therapeutics, peptide advancement, cutting-edge peptides, leading peptide research compounds, safe peptide handling, mixing instructions, reconstitution ratios, water volume for peptide reconstitution, IU conversion peptides, microgram dosage peptide, advanced peptide chemistries, peptide protocols Canada, melanin peptides, gh peptides, insulin-like growth peptide, muscle repair enhancement peptide, connective tissue peptide, peptide for joint injury recovery, peptide scar healing, peptide wound regeneration, peptide vascular improvement, peptide hormone boosters, peptide endocrine function, and more.
Skip to product information

LL-37

LL-37

SKU:Immune Defense Support

$119.99
In Stock Badge

chat 24/7 Customer Support

labs Lab tested for purity & quality

local_shipping Ships from Canada within 24 hours

 
Shipping Icon
Free shipping on orders $300 & up Automatically applied at checkout

LL-37 is a naturally occurring antimicrobial peptide that strengthens immune defenses and promotes tissue healing. It plays a role in fighting pathogens, reducing inflammation, and accelerating recovery from injuries or infections. LL-37 supplementation supports overall immunity, improves skin and wound healing, and enhances the body’s natural protective barriers.

Product Info

Molecular formula: C178H303N51O34
Molecular weight: 4493.0
Purity: 99%+
Sequence: [LL-37, 37 aa]

Disclaimer: All peptides are for laboratory research use only. Not for human consumption. We do not accept liability for misuse. (view full Terms of Use)
View full details

Customer reviews

0.0 /5
(0 reviews)

You may also like

GLP-3 Peptide

$179.99 From $169.99 CAD

GHK-Cu

$59.99 From $49.99 CAD

BPC-157

$59.99 From $49.99 CAD

CJC-1295 + Ipamorelin

$104.99 From $94.99 CAD

MOTS-c

$69.99 From $39.99 CAD

TB-500

$69.99 From $59.99 CAD

BPC-157 + TB-500

$199.99 From $179.99 CAD

IGF-1 LR3

$119.99 From $104.99 CAD

SLU-PP-332

$159.99 From $149.99 CAD

Klow

From $219.99 CAD

NAD

$69.99 From $44.99 CAD

Tirzepatide

$102.99 From $79.99 CAD

Tesamorelin

$174.99 From $159.99 CAD

MT-2 (Melanotan II)

$69.99 From $59.99 CAD

MT-1 (Melanotan I)

$69.99 From $59.99 CAD

PT-141 (Bremelanotide)

$69.99 From $59.99 CAD

Selank

From $39.99 CAD

Oxytocin

$92.99 From $49.99 CAD

Semax

From $59.99 CAD

5-Amino-1MQ

$94.99 From $84.99 CAD

AOD-9604

From $104.99 CAD

KPV

From $74.99 CAD

SS-31

$89.99 From $79.99 CAD

Epitalon

$69.99 From $59.99 CAD

Glutathione

$149.99 From $129.99 CAD

Sermorelin

$179.99 From $159.99 CAD

DSIP

From $124.99 CAD

HCG

From $79.99 CAD

Glow

From $179.99 CAD

Ipamorelin

$102.99 From $59.99 CAD

Semaglutide

$102.99 From $79.99 CAD

LL-37

From $119.99 CAD

Thymalin

$92.99 From $59.99 CAD

GHRP-6

$102.99 From $59.99 CAD

Hexarelin

$102.99 From $99.99 CAD

B12 (Cobalamin)

$99.99 From $89.99 CAD