LL-37
Immune Defense Support
Polar Peptides is Canada's only domestic manufacturer and supplier of premium research peptides, with production and fulfillment handled in Canada. While many sellers rely on imported vials from overseas suppliers, our domestic process allows us to maintain closer oversight over quality, consistency, packaging, and labeled vial weight.
By keeping peptide production closer to home, we can better control product standards, reduce reliance on uncertain imported inventory, and provide Canadian researchers with a more transparent and reliable source for research peptides.
Do not be fooled by vague "Made in Canada" claims. Many companies may ship from Canada while still sourcing finished vials from overseas. Polar Peptides is focused on true domestic manufacturing, premium research quality, fast Canadian shipping, and dependable customer support.
LL-37 is a naturally occurring antimicrobial peptide that strengthens immune defenses and promotes tissue healing. It plays a role in fighting pathogens, reducing inflammation, and accelerating recovery from injuries or infections. LL-37 supplementation supports overall immunity, improves skin and wound healing, and enhances the body’s natural protective barriers.
Product Info
Molecular formula: C178H303N51O34
Molecular weight: 4493.0
Purity: 99%+
Sequence: LLGDFFRKSKEKIGKEFKRIVQRIKDFLRNLVPRTES
Most standard lyophilized research vials are commonly prepared using 2mL of bacteriostatic water unless otherwise specified directly on the product page or vial label.
For best handling, slowly add the bacteriostatic water down the inside wall of the vial rather than directly onto the powder. This helps reduce unnecessary agitation and supports product integrity during laboratory use.
After adding bacteriostatic water, gently swirl or roll the vial until the lyophilized powder has fully dissolved. Avoid aggressive shaking, as excessive agitation may affect product stability.
Prepared vials should typically be stored refrigerated between 2-8°C for best stability. Lyophilized vials that have not yet been prepared should be stored in a cool, dry environment away from direct sunlight, moisture, and excessive heat.
Proper storage and handling procedures are important for maintaining product purity, consistency, and reliability throughout laboratory applications.
Use our calculator for accurate concentration calculations, measurement planning, and preparation guidance:
Polar Peptides provides premium-quality research products, laboratory-use compounds, and analytical materials with fast Canadian shipping and strict quality control standards.
All products sold by Polar Peptides are intended strictly for research use only and are not intended for human consumption, medical use, diagnostic use, or any other unauthorized use.
Lyophilized research products should be stored in a cool, dry environment prior to preparation to help maintain long-term stability and purity.
Refrigeration is recommended for most products after opening. Prepared vials should remain refrigerated between 2-8°C and protected from repeated temperature changes.
Exposure to excessive moisture, heat, direct sunlight, or frequent freeze-thaw cycles may negatively impact product stability during laboratory applications.
Polar Peptides supplies high-purity research products, peptide blends, laboratory-use materials, and advanced analytical compounds manufactured with quality, consistency, and secure packaging in mind.
Proper storage and handling procedures are recommended to maintain product integrity, consistency, and analytical reliability throughout laboratory research environments.
Peptides are short chains of amino acids that act as signaling molecules within the body. They are involved in a wide range of biological processes, including tissue repair, immune response, and cellular communication.
In research settings, peptides are studied for their ability to interact with specific receptors and pathways, making them valuable tools for scientific and laboratory analysis.
All peptides sold by Polar Peptides are intended strictly for research and laboratory use only and are not approved for human consumption.
All peptides are supplied in lyophilized (freeze-dried) form to ensure long-term stability during storage and shipping.
Unreconstituted vials should be stored in a cool, dry place away from direct light. For extended storage, refrigeration is recommended.
Once reconstituted for research purposes, peptides should be kept refrigerated and handled using sterile laboratory practices to maintain integrity.
Proper storage and handling are essential to preserve peptide stability, purity, and accuracy in research applications.
All orders are shipped directly from our Canadian fulfillment centre within 24 hours (Monday–Friday), ensuring fast and reliable shipping for all peptide products.
Delivery typically takes 2–5 business days depending on your location and the shipping method selected at checkout. We partner with trusted carriers to ensure secure and temperature-stable transit where required.
Once your order ships, a confirmation email with a real-time tracking number will be sent so you can monitor your package every step of the way.
We are committed to providing fast delivery across Canada, making Polar Peptides one of the most reliable peptide suppliers in the country.
We currently accept secure payments via Interac e-Transfer, the safest and fastest method for Canadian customers purchasing research peptides.
After placing your order, you will automatically receive an email with clear and detailed payment instructions. This ensures accurate payment processing and helps us ship your order without delay.
Your order will be prepared and shipped as soon as payment is successfully received and confirmed by our system.
Need step-by-step guidance? View our full instructions below:
(View Full Payment Instructions)
We strive to make the payment process simple, safe, and smooth for all customers purchasing peptides in Canada.
Each vial contains peptides at approximately 104% of the labeled amount, providing full accuracy and consistency for research applications.
All vials arrive as lyophilized (freeze-dried) powder requiring reconstitution with bacteriostatic water. This is necessary because once reconstituted with liquid, they must be refrigerated to maintain stability. We do not ship reconstituted peptides.
Vial dimensions are standardized at 16mm diameter and 38mm height, with a maximum fill capacity of 3ml. This ensures compatibility with common research-use storage and reconstitution tools.
Our packaging and vial quality meet high industry standards, offering consistent quality across all peptide batches.
All peptides offered by Polar Peptides undergo strict quality-control procedures, including independent third-party analytical testing for purity, identity, and consistency.
We use advanced testing methods such as HPLC (High-Performance Liquid Chromatography) and Mass Spectrometry to verify that each peptide meets the required research-grade standards.
Every batch is tested before being released, and full Certificates of Analysis (COAs) can be provided upon request. This includes data on purity percentage, molecular confirmation, and batch identification.
For the most up-to-date COAs and lab documentation, simply email us and our team will send the current testing reports for the specific peptide(s) you are interested in.
We are committed to transparency, accuracy, and reliability—ensuring that researchers across Canada receive high-quality, fully verified peptide products every time.
Note: Due to factors such as U.S. cross-border shipping delays, laboratory backlog, and the fact that we offer over 40 different products, it is not always possible to have up-to-date or readily available COAs for every batch. We always strive to provide them when possible, but please understand that COAs may not always be available immediately.
Customer reviews































Write a review
You may also like
- Choosing a selection results in a full page refresh.
- Opens in a new window.
Cart • 0 items
No products in the cart.

Alcohol Wipes
$2.99 – $8.99Price range: $2.99 through $8.99
BAC Water
$19.99
Peptide Syringes
$11.99 – $39.99Price range: $11.99 through $39.99August 2026 Savings
Apply the following code at checkout based on order size before tax and shipping.
Code POLAR10
Code POLAR20
Code POLAR25
Code POLAR30
Code POLAR35
Code POLAR40
Discounts must be entered manually at checkout.


























